SCOPe 2.07: Domain d1tw9a2: 1tw9 A:3-77

Lineage for d1tw9a2 (1tw9 A:3-77)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class sigma GST [81362] (5 species)

7. Species Heligmosomoides polygyrus [TaxId:6339] [110608] (1 PDB entry)
   Uniprot Q9NJQ6 # Fragment

8. Domain d1tw9a2: 1tw9 A:3-77 [107382]
   Other proteins in same PDB: d1tw9a1, d1tw9a3, d1tw9b1, d1tw9b3, d1tw9c1, d1tw9c3, d1tw9d1, d1tw9d3, d1tw9e1, d1tw9e3, d1tw9f1, d1tw9f3, d1tw9g1, d1tw9g3, d1tw9h1, d1tw9h3

Details for d1tw9a2

PDB Entry: 1tw9, 1.71 Å

PDB Description: Glutathione Transferase-2, apo form, from the nematode Heligmosomoides polygyrus

PDB Compounds: (A:) Glutathione S-transferase 2

SCOPe Domain Sequences for d1tw9a2:

Sequence; same for both SEQRES and ATOM records:

>d1tw9a2 c.47.1.5 (A:3-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]}
hykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqqla
qsqaicrylaktfgf

Timeline for d1tw9a2:

• d1tw9a2 first appeared in SCOP 1.69
  
• d1tw9a2 appears in SCOPe 2.06
  
• d1tw9a2 appears in the current release, SCOPe 2.08