SCOPe 2.01: Domain d1tw8d_: 1tw8 D:

Lineage for d1tw8d_ (1tw8 D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families)

5. Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)

6. Protein Restriction endonuclease HincII [69526] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [69527] (18 PDB entries)
   Uniprot P17743 ! Uniprot P44413

8. Domain d1tw8d_: 1tw8 D: [107380]
   protein/DNA complex; complexed with ca, na

Details for d1tw8d_

PDB Entry: 1tw8, 2.8 Å

PDB Description: hincii bound to ca2+ and cognate dna gtcgac

PDB Compounds: (D:) Type II restriction enzyme HindII

SCOPe Domain Sequences for d1tw8d_:

Sequence; same for both SEQRES and ATOM records:

>d1tw8d_ c.52.1.19 (D:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkky

Timeline for d1tw8d_:

• d1tw8d_ first appeared in SCOP 1.69
  
• d1tw8d_ appears in SCOP 1.75
  
• d1tw8d_ appears in SCOPe 2.02
  
• d1tw8d_ appears in the current release, SCOPe 2.08