| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
| Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein) automatically mapped to Pfam PF09226 |
| Protein Restriction endonuclease HincII [69526] (1 species) |
| Species Haemophilus influenzae [TaxId:727] [69527] (19 PDB entries) Uniprot P17743 ! Uniprot P44413 |
| Domain d1tw8d_: 1tw8 D: [107380] protein/DNA complex; complexed with ca, na |
PDB Entry: 1tw8 (more details), 2.8 Å
SCOPe Domain Sequences for d1tw8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tw8d_ c.52.1.19 (D:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkky
Timeline for d1tw8d_: