Lineage for d1tw8c_ (1tw8 C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371642Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1371643Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1371890Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)
    automatically mapped to Pfam PF09226
  6. 1371891Protein Restriction endonuclease HincII [69526] (1 species)
  7. 1371892Species Haemophilus influenzae [TaxId:727] [69527] (18 PDB entries)
    Uniprot P17743 ! Uniprot P44413
  8. 1371920Domain d1tw8c_: 1tw8 C: [107379]
    protein/DNA complex; complexed with ca, na

Details for d1tw8c_

PDB Entry: 1tw8 (more details), 2.8 Å

PDB Description: hincii bound to ca2+ and cognate dna gtcgac
PDB Compounds: (C:) Hinc II endonuclease

SCOPe Domain Sequences for d1tw8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw8c_ c.52.1.19 (C:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkkyil

SCOPe Domain Coordinates for d1tw8c_:

Click to download the PDB-style file with coordinates for d1tw8c_.
(The format of our PDB-style files is described here.)

Timeline for d1tw8c_: