Lineage for d1tw8c_ (1tw8 C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585880Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 585881Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families) (S)
  5. 586092Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)
  6. 586093Protein Restriction endonuclease HincII [69526] (1 species)
  7. 586094Species Haemophilus influenzae [TaxId:727] [69527] (4 PDB entries)
  8. 586101Domain d1tw8c_: 1tw8 C: [107379]

Details for d1tw8c_

PDB Entry: 1tw8 (more details), 2.8 Å

PDB Description: hincii bound to ca2+ and cognate dna gtcgac

SCOP Domain Sequences for d1tw8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw8c_ c.52.1.19 (C:) Restriction endonuclease HincII {Haemophilus influenzae}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkkyil

SCOP Domain Coordinates for d1tw8c_:

Click to download the PDB-style file with coordinates for d1tw8c_.
(The format of our PDB-style files is described here.)

Timeline for d1tw8c_: