Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) |
Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein) |
Protein Restriction endonuclease HincII [69526] (1 species) |
Species Haemophilus influenzae [TaxId:727] [69527] (18 PDB entries) Uniprot P17743 ! Uniprot P44413 |
Domain d1tw8a_: 1tw8 A: [107377] protein/DNA complex; complexed with ca, na |
PDB Entry: 1tw8 (more details), 2.8 Å
SCOPe Domain Sequences for d1tw8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tw8a_ c.52.1.19 (A:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]} sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr aismidkfvkpfkkyil
Timeline for d1tw8a_: