Lineage for d1tw2b2 (1tw2 B:99-351)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588626Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 588627Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families) (S)
  5. 588751Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (5 proteins)
  6. 588767Protein Carminomycin 4-O-methyltransferase [110660] (1 species)
  7. 588768Species Streptomyces peucetius [TaxId:1950] [110661] (2 PDB entries)
  8. 588772Domain d1tw2b2: 1tw2 B:99-351 [107372]
    Other proteins in same PDB: d1tw2a1, d1tw2b1
    complexed with ert, sah

Details for d1tw2b2

PDB Entry: 1tw2 (more details), 2.5 Å

PDB Description: Crystal structure of Carminomycin-4-O-methyltransferase (DnrK) in complex with S-adenosyl-L-homocystein (SAH) and 4-methoxy-e-rhodomycin T (M-ET)

SCOP Domain Sequences for d1tw2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw2b2 c.66.1.12 (B:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius}
paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl
lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar
sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr
iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt
ipydlsllvlapa

SCOP Domain Coordinates for d1tw2b2:

Click to download the PDB-style file with coordinates for d1tw2b2.
(The format of our PDB-style files is described here.)

Timeline for d1tw2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tw2b1