SCOPe 2.08: Domain d1tw2b2: 1tw2 B:99-352

Lineage for d1tw2b2 (1tw2 B:99-352)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
   automatically mapped to Pfam PF00891

6. Protein Carminomycin 4-O-methyltransferase [110660] (1 species)

7. Species Streptomyces peucetius [TaxId:1950] [110661] (6 PDB entries)
   Uniprot Q06528

8. Domain d1tw2b2: 1tw2 B:99-352 [107372]
   Other proteins in same PDB: d1tw2a1, d1tw2b1
   complexed with ert, sah

Details for d1tw2b2

PDB Entry: 1tw2, 2.5 Å

PDB Description: Crystal structure of Carminomycin-4-O-methyltransferase (DnrK) in complex with S-adenosyl-L-homocystein (SAH) and 4-methoxy-e-rhodomycin T (M-ET)

PDB Compounds: (B:) Carminomycin 4-O-methyltransferase

SCOPe Domain Sequences for d1tw2b2:

Sequence; same for both SEQRES and ATOM records:

>d1tw2b2 c.66.1.12 (B:99-352) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl
lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar
sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr
iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt
ipydlsllvlapaa

Timeline for d1tw2b2:

• d1tw2b2 first appeared in SCOP 1.69
  
• d1tw2b2 appears in SCOPe 2.07