Lineage for d1tw2b1 (1tw2 B:3-98)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983525Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
    unknown function
  6. 1983541Protein Carminomycin 4-O-methyltransferase [109667] (1 species)
  7. 1983542Species Streptomyces peucetius [TaxId:1950] [109668] (6 PDB entries)
    Uniprot Q06528
  8. 1983554Domain d1tw2b1: 1tw2 B:3-98 [107371]
    Other proteins in same PDB: d1tw2a2, d1tw2b2
    complexed with ert, sah

Details for d1tw2b1

PDB Entry: 1tw2 (more details), 2.5 Å

PDB Description: Crystal structure of Carminomycin-4-O-methyltransferase (DnrK) in complex with S-adenosyl-L-homocystein (SAH) and 4-methoxy-e-rhodomycin T (M-ET)
PDB Compounds: (B:) Carminomycin 4-O-methyltransferase

SCOPe Domain Sequences for d1tw2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw2b1 a.4.5.29 (B:3-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
eptvaarpqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpe
allrlirhlvaiglleedapgefvptevgelladdh

SCOPe Domain Coordinates for d1tw2b1:

Click to download the PDB-style file with coordinates for d1tw2b1.
(The format of our PDB-style files is described here.)

Timeline for d1tw2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tw2b2