Lineage for d1tvza2 (1tvz A:168-388)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 593921Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 593922Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 594204Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
  6. 594205Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (1 species)
    most similar to FabH
  7. 594206Species Staphylococcus aureus [TaxId:1280] [110761] (5 PDB entries)
  8. 594208Domain d1tvza2: 1tvz A:168-388 [107368]
    complexed with so4

Details for d1tvza2

PDB Entry: 1tvz (more details), 2 Å

PDB Description: Crystal structure of 3-hydroxy-3-methylglutaryl-coenzyme A synthase from Staphylococcus aureus

SCOP Domain Sequences for d1tvza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvza2 c.95.1.2 (A:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus}
ilalnedavaytedvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladf
aslcfhvpftkmgkkalesiidnadettqerlrsgyedavdynryvgniytgslylslis
llenrdlqagetiglfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdaye
tffkrfddvefdeeqdavhedrhifylsniennvreyhrpe

SCOP Domain Coordinates for d1tvza2:

Click to download the PDB-style file with coordinates for d1tvza2.
(The format of our PDB-style files is described here.)

Timeline for d1tvza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tvza1