Lineage for d1tvza2 (1tvz A:168-388)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2916988Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain [419029] (2 species)
    most similar to FabH
  7. Species Staphylococcus aureus [TaxId:1280] [419513] (5 PDB entries)
    Uniprot Q7A3F6
  8. 2917003Domain d1tvza2: 1tvz A:168-388 [107368]
    Other proteins in same PDB: d1tvza1
    complexed with so4
    has additional subdomain(s) that are not in the common domain

Details for d1tvza2

PDB Entry: 1tvz (more details), 2 Å

PDB Description: Crystal structure of 3-hydroxy-3-methylglutaryl-coenzyme A synthase from Staphylococcus aureus
PDB Compounds: (A:) 3-hydroxy-3-methylglutaryl-CoA synthase

SCOPe Domain Sequences for d1tvza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvza2 c.95.1.2 (A:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
ilalnedavaytedvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladf
aslcfhvpftkmgkkalesiidnadettqerlrsgyedavdynryvgniytgslylslis
llenrdlqagetiglfsygsgsvvefysatlvegykdhldqaahkallnnrtevsvdaye
tffkrfddvefdeeqdavhedrhifylsniennvreyhrpe

SCOPe Domain Coordinates for d1tvza2:

Click to download the PDB-style file with coordinates for d1tvza2.
(The format of our PDB-style files is described here.)

Timeline for d1tvza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tvza1