Lineage for d1tvza1 (1tvz A:2-167)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627154Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1627155Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (2 species)
    most similar to FabH
  7. 1627181Species Staphylococcus aureus [TaxId:1280] [110761] (5 PDB entries)
    Uniprot Q7A3F6
  8. 1627182Domain d1tvza1: 1tvz A:2-167 [107367]
    complexed with so4

Details for d1tvza1

PDB Entry: 1tvz (more details), 2 Å

PDB Description: Crystal structure of 3-hydroxy-3-methylglutaryl-coenzyme A synthase from Staphylococcus aureus
PDB Compounds: (A:) 3-hydroxy-3-methylglutaryl-CoA synthase

SCOPe Domain Sequences for d1tvza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvza1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]}
tigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnps

SCOPe Domain Coordinates for d1tvza1:

Click to download the PDB-style file with coordinates for d1tvza1.
(The format of our PDB-style files is described here.)

Timeline for d1tvza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tvza2