Lineage for d1tvla_ (1tvl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089162Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2089206Family c.1.16.4: Ssud-like monoxygenases [82275] (2 protein domains)
  6. 2089212Protein Putative monooxygenase YtnJ [110380] (1 species)
  7. 2089213Species Bacillus subtilis [TaxId:1423] [110381] (2 PDB entries)
    Uniprot O34974
  8. 2089214Domain d1tvla_: 1tvl A: [107366]

Details for d1tvla_

PDB Entry: 1tvl (more details), 2.1 Å

PDB Description: Structure of YTNJ from Bacillus subtilis
PDB Compounds: (A:) protein YTNJ

SCOPe Domain Sequences for d1tvla_:

Sequence, based on SEQRES records: (download)

>d1tvla_ c.1.16.4 (A:) Putative monooxygenase YtnJ {Bacillus subtilis [TaxId: 1423]}
radfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiadglfi
seksiphflnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisggrag
wnlvtspqegaarnhsksnlpehteryeiaqehldvvrglwnswehdafihnkktgqffd
qaklhrlnhkgkyfqvegplnigrskqgepvvfqagssetgrqfaaknadaifthsnsle
etkafyadvksraadegrdpssvrifpgispivadteeeaekkyrefaelipienavtyl
arffddydlsvypldepfpdigdvgknafqsttdrikreakarnltlrevaqemafprtl
figtpervaslietwfnaeaadgfivgsdipgtldafvekvipilqerglyrqdyrggtl
renlglgipq

Sequence, based on observed residues (ATOM records): (download)

>d1tvla_ c.1.16.4 (A:) Putative monooxygenase YtnJ {Bacillus subtilis [TaxId: 1423]}
radfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiadglfi
seksiphflnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisggrag
wnlvtspqegaarnhsksnlpehteryeiaqehldvvrglwnswehdafihnkktgqffd
qaklhrlnhkgkyfqvegplnigrskqgepvvfqagssetgrqfaaknadaifthsnsle
etkafyadvksraadegrdpssvrifpgispivadteeeaekkyrefaelipienavtea
karnltlrevaqemafprtlfigtpervaslietwfnaeaadgfivgsdipgtldafvek
vipilqerglyrqdyrggtlrenlglgipq

SCOPe Domain Coordinates for d1tvla_:

Click to download the PDB-style file with coordinates for d1tvla_.
(The format of our PDB-style files is described here.)

Timeline for d1tvla_: