![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein Tubulin beta-subunit [55313] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [64322] (5 PDB entries) Uniprot P02554 |
![]() | Domain d1tvkb2: 1tvk B:246-427 [107365] Other proteins in same PDB: d1tvka1, d1tvka2, d1tvkb1 complexed with ep, gdp, gtp |
PDB Entry: 1tvk (more details), 2.89 Å
SCOPe Domain Sequences for d1tvkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvkb2 d.79.2.1 (B:246-427) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]} lnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaacdp rhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsa tfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqy qd
Timeline for d1tvkb2: