| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein Tubulin beta-subunit [52496] (2 species) |
| Species Cow (Bos taurus) [TaxId:9913] [63990] (5 PDB entries) Uniprot P02550 ! Uniprot P02554 |
| Domain d1tvkb1: 1tvk B:2-245 [107364] Other proteins in same PDB: d1tvka2, d1tvkb2 complexed with ep, gdp, gtp |
PDB Entry: 1tvk (more details), 2.89 Å
SCOPe Domain Sequences for d1tvkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvkb1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fpgq
Timeline for d1tvkb1: