SCOP 1.71: Domain d1tvkb1: 1tvk B:2-245

Lineage for d1tvkb1 (1tvk B:2-245)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family)

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)

6. Protein Tubulin beta-subunit [52496] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [63990] (4 PDB entries)

8. Domain d1tvkb1: 1tvk B:2-245 [107364]
   Other proteins in same PDB: d1tvka2, d1tvkb2
   complexed with ep, gdp, gtp

Details for d1tvkb1

PDB Entry: 1tvk, 2.89 Å

PDB Description: the binding mode of epothilone a on a,b-tubulin by electron crystallography

SCOP Domain Sequences for d1tvkb1:

Sequence; same for both SEQRES and ATOM records:

>d1tvkb1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus)}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fpgq

Timeline for d1tvkb1:

• d1tvkb1 first appeared in SCOP 1.69
  
• d1tvkb1 appears in SCOP 1.73
  
• d1tvkb1 appears in the current release, SCOPe 2.08