Lineage for d1tvka1 (1tvk A:2-245)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 580909Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 580910Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 580911Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 580953Protein Tubulin beta-subunit [52496] (2 species)
  7. 580954Species Cow (Bos taurus) [TaxId:9913] [63990] (4 PDB entries)
  8. 580960Domain d1tvka1: 1tvk A:2-245 [107362]
    Other proteins in same PDB: d1tvka2, d1tvkb2
    complexed with ep, gdp, gtp

Details for d1tvka1

PDB Entry: 1tvk (more details), 2.89 Å

PDB Description: the binding mode of epothilone a on a,b-tubulin by electron crystallography

SCOP Domain Sequences for d1tvka1:

Sequence, based on SEQRES records: (download)

>d1tvka1 c.32.1.1 (A:2-245) Tubulin beta-subunit {Cow (Bos taurus)}
recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh
vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr
irkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav
vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitas
lrfd

Sequence, based on observed residues (ATOM records): (download)

>d1tvka1 c.32.1.1 (A:2-245) Tubulin beta-subunit {Cow (Bos taurus)}
recisihvgqagvqignacwelyclehgiqpdghvpravfvdleptvidevrtgtyrqlf
hpeqlitgkedaannyarghytigkeiidlvldrirkladqctglqgfsvfhsfgggtgs
gftsllmerlsvdygkksklefsiypapqvstavvepynsiltthttlehsdcafmvdne
aiydicrrnldierptytnlnrligqivssitaslrfd

SCOP Domain Coordinates for d1tvka1:

Click to download the PDB-style file with coordinates for d1tvka1.
(The format of our PDB-style files is described here.)

Timeline for d1tvka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tvka2