SCOPe 2.08: Domain d1tvfb2: 1tvf B:21-315

Lineage for d1tvfb2 (1tvf B:21-315)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Pencillin binding protein 4 (PbpD), N-terminal domain [111287] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [111288] (3 PDB entries)
   Uniprot Q53613 21-383

8. Domain d1tvfb2: 1tvf B:21-315 [107361]
   Other proteins in same PDB: d1tvfa1, d1tvfa3, d1tvfb1, d1tvfb3
   Structural genomics target
   complexed with so4, unl

Details for d1tvfb2

PDB Entry: 1tvf, 2 Å

PDB Description: crystal structure of penicillin-binding protein 4 (pbp4) from staphylococcus aureus

PDB Compounds: (B:) penicillin binding protein 4

SCOPe Domain Sequences for d1tvfb2:

Sequence; same for both SEQRES and ATOM records:

>d1tvfb2 e.3.1.1 (B:21-315) Pencillin binding protein 4 (PbpD), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
yaqatnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklm
tmyltleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnss
naaalilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptkykdqer
tvttardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglkt
gssdtanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

Timeline for d1tvfb2:

• d1tvfb2 first appeared in SCOP 1.69
  
• d1tvfb2 appears in SCOPe 2.07