Lineage for d1tvfb1 (1tvf B:316-383)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472057Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 472058Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (2 families) (S)
  5. 472066Family b.105.1.2: Pencillin binding protein 4 (PbpD), C-terminal domain [110098] (1 protein)
    rudiment form of the PBP-5-like domain
  6. 472067Protein Pencillin binding protein 4 (PbpD), C-terminal domain [110099] (1 species)
  7. 472068Species Staphylococcus aureus [TaxId:1280] [110100] (1 PDB entry)
  8. 472070Domain d1tvfb1: 1tvf B:316-383 [107360]
    Other proteins in same PDB: d1tvfa2, d1tvfb2
    Structural genomics target

Details for d1tvfb1

PDB Entry: 1tvf (more details), 2 Å

PDB Description: crystal structure of penicillin-binding protein 4 (pbp4) from staphylococcus aureus

SCOP Domain Sequences for d1tvfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvfb1 b.105.1.2 (B:316-383) Pencillin binding protein 4 (PbpD), C-terminal domain {Staphylococcus aureus}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

SCOP Domain Coordinates for d1tvfb1:

Click to download the PDB-style file with coordinates for d1tvfb1.
(The format of our PDB-style files is described here.)

Timeline for d1tvfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tvfb2