![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily) sandwich; 6 strands in 2 sheets |
![]() | Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (2 families) ![]() |
![]() | Family b.105.1.2: Pencillin binding protein 4 (PbpD), C-terminal domain [110098] (1 protein) rudiment form of the PBP-5-like domain |
![]() | Protein Pencillin binding protein 4 (PbpD), C-terminal domain [110099] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [110100] (1 PDB entry) |
![]() | Domain d1tvfb1: 1tvf B:316-383 [107360] Other proteins in same PDB: d1tvfa2, d1tvfb2 Structural genomics target |
PDB Entry: 1tvf (more details), 2 Å
SCOP Domain Sequences for d1tvfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvfb1 b.105.1.2 (B:316-383) Pencillin binding protein 4 (PbpD), C-terminal domain {Staphylococcus aureus} kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg pptvevhq
Timeline for d1tvfb1: