Lineage for d1tvfb1 (1tvf B:316-383)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820866Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2820867Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 2820888Family b.105.1.2: Pencillin binding protein 4 (PbpD), C-terminal domain [110098] (1 protein)
    rudiment form of the PBP-5-like domain
    automatically mapped to Pfam PF09211
  6. 2820889Protein Pencillin binding protein 4 (PbpD), C-terminal domain [110099] (1 species)
  7. 2820890Species Staphylococcus aureus [TaxId:1280] [110100] (3 PDB entries)
    Uniprot Q53613 21-383
  8. 2820892Domain d1tvfb1: 1tvf B:316-383 [107360]
    Other proteins in same PDB: d1tvfa2, d1tvfa3, d1tvfb2, d1tvfb3
    Structural genomics target
    complexed with so4, unl

Details for d1tvfb1

PDB Entry: 1tvf (more details), 2 Å

PDB Description: crystal structure of penicillin-binding protein 4 (pbp4) from staphylococcus aureus
PDB Compounds: (B:) penicillin binding protein 4

SCOPe Domain Sequences for d1tvfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvfb1 b.105.1.2 (B:316-383) Pencillin binding protein 4 (PbpD), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

SCOPe Domain Coordinates for d1tvfb1:

Click to download the PDB-style file with coordinates for d1tvfb1.
(The format of our PDB-style files is described here.)

Timeline for d1tvfb1: