Lineage for d1tvea2 (1tve A:151-340)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506899Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 506900Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 507115Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins)
  6. 507116Protein Homoserine dehydrogenase [55364] (1 species)
  7. 507117Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55365] (4 PDB entries)
  8. 507126Domain d1tvea2: 1tve A:151-340 [107355]
    Other proteins in same PDB: d1tvea1, d1tveb1

Details for d1tvea2

PDB Entry: 1tve (more details), 3 Å

PDB Description: Homoserine Dehydrogenase in complex with 4-(4-hydroxy-3-isopropylphenylthio)-2-isopropylphenol

SCOP Domain Sequences for d1tvea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvea2 d.81.1.2 (A:151-340) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae)}
piisflreiiqtgdevekiegifsgtlsyifnefstsqandvkfsdvvkvakklgytepd
prddlngldvarkvtivgrisgvevesptsfpvqslipkplesvksadefleklsdydkd
ltqlkkeaatenkvlrfigkvdvatksvsvgiekydyshpfaslkgsdnvisiktkrytn
pvviqgagag

SCOP Domain Coordinates for d1tvea2:

Click to download the PDB-style file with coordinates for d1tvea2.
(The format of our PDB-style files is described here.)

Timeline for d1tvea2:

Domains from same chain:
(mouse over for more information)
d1tvea1
Domains from other chains:
(mouse over for more information)
d1tveb1, d1tveb2