SCOPe 2.07: Domain d1tv8b_: 1tv8 B:

Lineage for d1tv8b_ (1tv8 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.28: Radical SAM enzymes [102114] (3 families)
   common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel

5. Family c.1.28.3: MoCo biosynthesis proteins [110388] (1 protein)
   open alpha/beta-barrel with a specific second FeS cluster-binding region corresponding to Pfam PF06463

6. Protein Molybdenum cofactor biosynthesis protein A MoaA [110389] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110390] (4 PDB entries)
   Uniprot P69848

8. Domain d1tv8b_: 1tv8 B: [107353]
   complexed with dtu, sam, sf4, so4

Details for d1tv8b_

PDB Entry: 1tv8, 2.2 Å

PDB Description: Structure of MoaA in complex with S-adenosylmethionine

PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein A

SCOPe Domain Sequences for d1tv8b_:

Sequence; same for both SEQRES and ATOM records:

>d1tv8b_ c.1.28.3 (B:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]}
qikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya
elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri
nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley
fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh
kdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelke
qfkalwqirddrysdertaqtvanrq

Timeline for d1tv8b_:

• d1tv8b_ first appeared in SCOP 1.69
  
• d1tv8b_ appears in SCOPe 2.06
  
• d1tv8b_ appears in the current release, SCOPe 2.08