Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.28: Radical SAM enzymes [102114] (3 families) common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel |
Family c.1.28.3: MoCo biosynthesis proteins [110388] (1 protein) open alpha/beta-barrel with a specific second FeS cluster-binding region corresponding to Pfam PF06463 |
Protein Molybdenum cofactor biosynthesis protein A MoaA [110389] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [110390] (4 PDB entries) Uniprot P69848 |
Domain d1tv7b_: 1tv7 B: [107351] complexed with sf4, so4 |
PDB Entry: 1tv7 (more details), 2.8 Å
SCOPe Domain Sequences for d1tv7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tv7b_ c.1.28.3 (B:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]} qikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh kdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelke qfkalwqirddrysdertaqtvanrq
Timeline for d1tv7b_: