SCOP 1.69: Domain d1tv7b_: 1tv7 B:

Lineage for d1tv7b_ (1tv7 B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.28: Radical SAM enzymes [102114] (3 families)
   common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel

5. Family c.1.28.3: MoCo biosynthesis proteins [110388] (1 protein)
   open alpha/beta-barrel with a specific second FeS cluster-binding region corresponding to Pfam 06463

6. Protein Molybdenum cofactor biosynthesis protein A MoaA [110389] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110390] (2 PDB entries)

8. Domain d1tv7b_: 1tv7 B: [107351]

Details for d1tv7b_

PDB Entry: 1tv7, 2.8 Å

PDB Description: Structure of the S-adenosylmethionine dependent Enzyme MoaA

SCOP Domain Sequences for d1tv7b_:

Sequence; same for both SEQRES and ATOM records:

>d1tv7b_ c.1.28.3 (B:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus}
qikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya
elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri
nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley
fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh
kdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelke
qfkalwqirddrysdertaqtvanrq

Timeline for d1tv7b_:

• d1tv7b_ is new in SCOP 1.69
  
• d1tv7b_ appears in SCOP 1.71
  
• d1tv7b_ appears in the current release, SCOPe 2.08