Lineage for d1tv7b_ (1tv7 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840845Superfamily c.1.28: Radical SAM enzymes [102114] (3 families) (S)
    common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel
  5. 2840855Family c.1.28.3: MoCo biosynthesis proteins [110388] (1 protein)
    open alpha/beta-barrel with a specific second FeS cluster-binding region corresponding to Pfam PF06463
  6. 2840856Protein Molybdenum cofactor biosynthesis protein A MoaA [110389] (1 species)
  7. 2840857Species Staphylococcus aureus [TaxId:1280] [110390] (4 PDB entries)
    Uniprot P69848
  8. 2840865Domain d1tv7b_: 1tv7 B: [107351]
    complexed with sf4, so4

Details for d1tv7b_

PDB Entry: 1tv7 (more details), 2.8 Å

PDB Description: Structure of the S-adenosylmethionine dependent Enzyme MoaA
PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein A

SCOPe Domain Sequences for d1tv7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tv7b_ c.1.28.3 (B:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]}
qikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya
elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri
nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley
fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh
kdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelke
qfkalwqirddrysdertaqtvanrq

SCOPe Domain Coordinates for d1tv7b_:

Click to download the PDB-style file with coordinates for d1tv7b_.
(The format of our PDB-style files is described here.)

Timeline for d1tv7b_: