Lineage for d1tv6a1 (1tv6 A:430-539)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2885834Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2885885Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 2885895Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2885951Domain d1tv6a1: 1tv6 A:430-539 [107347]
    Other proteins in same PDB: d1tv6a2, d1tv6b1
    complexed with cp9

Details for d1tv6a1

PDB Entry: 1tv6 (more details), 2.8 Å

PDB Description: HIV-1 Reverse Transcriptase Complexed with CP-94,707
PDB Compounds: (A:) Reverse transcriptase P66 SUBUNIT

SCOPe Domain Sequences for d1tv6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tv6a1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpah

SCOPe Domain Coordinates for d1tv6a1:

Click to download the PDB-style file with coordinates for d1tv6a1.
(The format of our PDB-style files is described here.)

Timeline for d1tv6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tv6a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1tv6b1