SCOPe 2.06: Domain d1tuwa_: 1tuw A:

Lineage for d1tuwa_ (1tuw A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.8: Polyketide synthesis cyclase [110959] (1 protein)
   Pfam PF04673

6. Protein Tetracenomycin polyketide synthesis protein TcmI [110960] (1 species)

7. Species Streptomyces glaucescens [TaxId:1907] [110961] (1 PDB entry)
   Uniprot P39890

8. Domain d1tuwa_: 1tuw A: [107346]
   complexed with so4

Details for d1tuwa_

PDB Entry: 1tuw, 1.9 Å

PDB Description: structural and functional analysis of tetracenomycin f2 cyclase from streptomyces glaucescens: a type-ii polyketide cyclase

PDB Compounds: (A:) Tetracenomycin polyketide synthesis protein tcmI

SCOPe Domain Sequences for d1tuwa_:

Sequence; same for both SEQRES and ATOM records:

>d1tuwa_ d.58.4.8 (A:) Tetracenomycin polyketide synthesis protein TcmI {Streptomyces glaucescens [TaxId: 1907]}
ayralmvlrmdpadaehvaaafaehdttelpleigvrrrvlfrfhdlymhlieadddime
rlyqarshplfqevnervgqyltpyaqdweelkdskaevfyswtap

Timeline for d1tuwa_:

• d1tuwa_ first appeared in SCOP 1.69
  
• d1tuwa_ appears in SCOPe 2.05
  
• d1tuwa_ appears in SCOPe 2.07
  
• d1tuwa_ appears in the current release, SCOPe 2.08