Lineage for d1tufb1 (1tuf B:15-49,B:314-448)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798988Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2799024Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 2799025Protein Diaminopimelate decarboxylase LysA [89350] (3 species)
  7. 2799029Species Methanococcus jannaschii [TaxId:2190] [110245] (2 PDB entries)
    Uniprot Q58497
  8. 2799035Domain d1tufb1: 1tuf B:15-49,B:314-448 [107337]
    Other proteins in same PDB: d1tufa2, d1tufb2
    Structural genomics target
    complexed with az1

Details for d1tufb1

PDB Entry: 1tuf (more details), 2.4 Å

PDB Description: crystal structure of diaminopimelate decarboxylase from m. jannaschi
PDB Compounds: (B:) diaminopimelate decarboxylase

SCOPe Domain Sequences for d1tufb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tufb1 b.49.2.3 (B:15-49,B:314-448) Diaminopimelate decarboxylase LysA {Methanococcus jannaschii [TaxId: 2190]}
flgndtveikdgrffidgydaielaekfgtplyvmXgyllgkvhhiketpvtkwvmidag
mndmmrpamyeayhhiinckvknekevvsiagglcessdvfgrdreldkvevgdvlaifd
vgaygismannynargrprmvltskkgvflireretyadliakdivpphll

SCOPe Domain Coordinates for d1tufb1:

Click to download the PDB-style file with coordinates for d1tufb1.
(The format of our PDB-style files is described here.)

Timeline for d1tufb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tufb2