SCOPe 2.05: Domain d1tuel_: 1tue L:

Lineage for d1tuel_ (1tue L:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.91: E2 regulatory, transactivation domain [51331] (1 superfamily)
   complex fold made of bifurcated and coiled beta-sheets

4. Superfamily b.91.1: E2 regulatory, transactivation domain [51332] (2 families)
   automatically mapped to Pfam PF00508

5. Family b.91.1.1: E2 regulatory, transactivation domain [51333] (1 protein)

6. Protein E2 regulatory, transactivation domain [51334] (3 species)

7. Species Human papillomavirus type 18 [TaxId:333761] [51335] (2 PDB entries)
   Uniprot Q80B71 1-193

8. Domain d1tuel_: 1tue L: [107332]
   Other proteins in same PDB: d1tuea_, d1tued_, d1tuef_, d1tueh_, d1tuek_, d1tuem_
   includes the N-terminal alpha-helical region (1-90), binding the E1 helicase domain

Details for d1tuel_

PDB Entry: 1tue, 2.1 Å

PDB Description: The X-ray Structure of the Papillomavirus Helicase in Complex with its Molecular Matchmaker E2

PDB Compounds: (L:) Regulatory protein E2

SCOPe Domain Sequences for d1tuel_:

Sequence, based on SEQRES records:

>d1tuel_ b.91.1.1 (L:) E2 regulatory, transactivation domain {Human papillomavirus type 18 [TaxId: 333761]}
pketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqtlnhqvv
payniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggqtvqv
yfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefkseceky
gntgtwevhfgnnv

Sequence, based on observed residues (ATOM records):

>d1tuel_ b.91.1.1 (L:) E2 regulatory, transactivation domain {Human papillomavirus type 18 [TaxId: 333761]}
pketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqtlnhqvv
payniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggqtvqv
yfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefkseceky
gtgtwevhfgnnv

Timeline for d1tuel_:

• d1tuel_ first appeared in SCOP 1.69
  
• d1tuel_ appears in SCOPe 2.04
  
• d1tuel_ appears in SCOPe 2.06
  
• d1tuel_ appears in the current release, SCOPe 2.08