Lineage for d1tuef_ (1tue F:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 485481Family c.37.1.20: Extended AAA-ATPase domain [81269] (25 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 485673Protein Replication protein E1 helicase domain [110576] (1 species)
  7. 485674Species Human papillomavirus type 18 [TaxId:333761] [110577] (1 PDB entry)
  8. 485677Domain d1tuef_: 1tue F: [107327]
    Other proteins in same PDB: d1tueb_, d1tuee_, d1tueg_, d1tuej_, d1tuel_, d1tueq_

Details for d1tuef_

PDB Entry: 1tue (more details), 2.1 Å

PDB Description: The X-ray Structure of the Papillomavirus Helicase in Complex with its Molecular Matchmaker E2

SCOP Domain Sequences for d1tuef_:

Sequence, based on SEQRES records: (download)

>d1tuef_ c.37.1.20 (F:) Replication protein E1 helicase domain {Human papillomavirus type 18}
nmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknclvfcgpan
tgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyfdtymrnal
dgnpisidrkhkpliqlkcppillttnihpakdnrwpylesritvfefpnafpfdkngnp
vyeindknwkcffertwsrld

Sequence, based on observed residues (ATOM records): (download)

>d1tuef_ c.37.1.20 (F:) Replication protein E1 helicase domain {Human papillomavirus type 18}
nmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknclvfcgpan
tgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyfdtymrnal
dgnpkcppillttnihpakdnrwpylesritvfefpnafpfdkngnpvyeindknwkcff
ertwsrld

SCOP Domain Coordinates for d1tuef_:

Click to download the PDB-style file with coordinates for d1tuef_.
(The format of our PDB-style files is described here.)

Timeline for d1tuef_: