Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Replication protein E1 helicase domain [110576] (1 species) |
Species Human papillomavirus type 18 [TaxId:333761] [110577] (1 PDB entry) Uniprot P06789 428-629 # structure of the origin-binding domain (210-354) is also known, 1r9w (103119) |
Domain d1tued_: 1tue D: [107325] Other proteins in same PDB: d1tuea2, d1tueb1, d1tueb2, d1tuee_, d1tueg_, d1tuej_, d1tuel_, d1tueq_ fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1tue (more details), 2.1 Å
SCOPe Domain Sequences for d1tued_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tued_ c.37.1.20 (D:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} nmsqwirfrcskideggdwrpivqflryqqiefitflgalksflkgtpkknclvfcgpan tgksyfgmsfihfiqgavisfvnstshfwlepltdtkvamlddatttcwtyfdtymrnal dgnpisidrkhkpliqlkcppillttnihpakdnrwpylesritvfefpnafpfdkngnp vyeindknwkcffertwsrldl
Timeline for d1tued_: