Class b: All beta proteins [48724] (178 folds) |
Fold b.91: E2 regulatory, transactivation domain [51331] (1 superfamily) complex fold made of bifurcated and coiled beta-sheets |
Superfamily b.91.1: E2 regulatory, transactivation domain [51332] (2 families) automatically mapped to Pfam PF00508 |
Family b.91.1.1: E2 regulatory, transactivation domain [51333] (1 protein) |
Protein E2 regulatory, transactivation domain [51334] (3 species) |
Species Human papillomavirus type 18 [TaxId:333761] [51335] (2 PDB entries) Uniprot Q80B71 1-193 |
Domain d1tueb1: 1tue B:1-193 [107324] Other proteins in same PDB: d1tuea1, d1tuea2, d1tueb2, d1tued_, d1tuef_, d1tueh_, d1tuek_, d1tuem_ includes the N-terminal alpha-helical region (1-90), binding the E1 helicase domain |
PDB Entry: 1tue (more details), 2.1 Å
SCOPe Domain Sequences for d1tueb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tueb1 b.91.1.1 (B:1-193) E2 regulatory, transactivation domain {Human papillomavirus type 18 [TaxId: 333761]} mqtpketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqtlnh qvvpayniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggqt vqvyfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefksec ekygntgtwevhf
Timeline for d1tueb1: