SCOPe 2.07: Domain d1tueb1: 1tue B:1-193

Lineage for d1tueb1 (1tue B:1-193)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.91: E2 regulatory, transactivation domain [51331] (1 superfamily)
   complex fold made of bifurcated and coiled beta-sheets

4. Superfamily b.91.1: E2 regulatory, transactivation domain [51332] (2 families)
   automatically mapped to Pfam PF00508

5. Family b.91.1.1: E2 regulatory, transactivation domain [51333] (1 protein)

6. Protein E2 regulatory, transactivation domain [51334] (3 species)

7. Species Human papillomavirus type 18 [TaxId:333761] [51335] (2 PDB entries)
   Uniprot Q80B71 1-193

8. Domain d1tueb1: 1tue B:1-193 [107324]
   Other proteins in same PDB: d1tuea1, d1tuea2, d1tueb2, d1tued_, d1tuef_, d1tueh_, d1tuek_, d1tuem_
   includes the N-terminal alpha-helical region (1-90), binding the E1 helicase domain

Details for d1tueb1

PDB Entry: 1tue, 2.1 Å

PDB Description: The X-ray Structure of the Papillomavirus Helicase in Complex with its Molecular Matchmaker E2

PDB Compounds: (B:) Regulatory protein E2

SCOPe Domain Sequences for d1tueb1:

Sequence; same for both SEQRES and ATOM records:

>d1tueb1 b.91.1.1 (B:1-193) E2 regulatory, transactivation domain {Human papillomavirus type 18 [TaxId: 333761]}
mqtpketlserlsalqdkiidhyendskdidsqiqywqlirwenaiffaarehgiqtlnh
qvvpayniskskahkaielqmalqglaqsayktedwtlqdtceelwntepthcfkkggqt
vqvyfdgnkdncmtyvawdsvyymtdagtwdktatcvshrglyyvkegyntfyiefksec
ekygntgtwevhf

Timeline for d1tueb1:

• d1tueb1 first appeared in SCOP 1.69, called d1tueb_
  
• d1tueb1 appears in SCOPe 2.06
  
• d1tueb1 appears in the current release, SCOPe 2.08