Lineage for d1tuaa1 (1tua A:1-84)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412291Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1412292Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1412293Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 1412323Protein Hypothetical protein APE0754 [110927] (1 species)
    duplication: tandem repeat of two KH-1 domains
  7. 1412324Species Aeropyrum pernix [TaxId:56636] [110928] (1 PDB entry)
    Uniprot Q9YE16
  8. 1412325Domain d1tuaa1: 1tua A:1-84 [107321]

Details for d1tuaa1

PDB Entry: 1tua (more details), 1.5 Å

PDB Description: 1.5 A Crystal Structure of a Protein of Unknown Function APE0754 from Aeropyrum pernix
PDB Compounds: (A:) Hypothetical protein APE0754

SCOPe Domain Sequences for d1tuaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]}
mkpriyvkvkperlgavigprgevkaeimrrtgtvitvdtensmvivepeaegippvnlm
kaaevvkaislgfppekafrllee

SCOPe Domain Coordinates for d1tuaa1:

Click to download the PDB-style file with coordinates for d1tuaa1.
(The format of our PDB-style files is described here.)

Timeline for d1tuaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tuaa2