Lineage for d1tu9a_ (1tu9 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531486Protein Hypothetical protein PA3967 [109628] (1 species)
  7. 531487Species Pseudomonas aeruginosa [TaxId:287] [109629] (1 PDB entry)
  8. 531488Domain d1tu9a_: 1tu9 A: [107320]
    complexed with edo, hem, ppi

Details for d1tu9a_

PDB Entry: 1tu9 (more details), 1.2 Å

PDB Description: Crystal Structure of a Protein PA3967, a Structurally Highly Homologous to a Human Hemoglobin, from Pseudomonas aeruginosa PAO1

SCOP Domain Sequences for d1tu9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa}
naadrvmqsygrccastgffddfyrhflasspqirakfattdmtaqkhllragimnlvmy
argmsdsklralgashsraaldirpelydlwldallmavaehdrdcdaetrdawrdvmgr
giaviksyygs

SCOP Domain Coordinates for d1tu9a_:

Click to download the PDB-style file with coordinates for d1tu9a_.
(The format of our PDB-style files is described here.)

Timeline for d1tu9a_: