SCOP 1.69: Domain d1tu9a_: 1tu9 A:

Lineage for d1tu9a_ (1tu9 A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Hypothetical protein PA3967 [109628] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [109629] (1 PDB entry)

8. Domain d1tu9a_: 1tu9 A: [107320]

Details for d1tu9a_

PDB Entry: 1tu9, 1.2 Å

PDB Description: Crystal Structure of a Protein PA3967, a Structurally Highly Homologous to a Human Hemoglobin, from Pseudomonas aeruginosa PAO1

SCOP Domain Sequences for d1tu9a_:

Sequence; same for both SEQRES and ATOM records:

>d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa}
naadrvmqsygrccastgffddfyrhflasspqirakfattdmtaqkhllragimnlvmy
argmsdsklralgashsraaldirpelydlwldallmavaehdrdcdaetrdawrdvmgr
giaviksyygs

Timeline for d1tu9a_:

• d1tu9a_ is new in SCOP 1.69
  
• d1tu9a_ appears in SCOP 1.71
  
• d1tu9a_ appears in the current release, SCOPe 2.08, called d1tu9a1