Lineage for d1tu9a1 (1tu9 A:2-130)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687783Protein Hypothetical protein PA3967 [109628] (1 species)
  7. 2687784Species Pseudomonas aeruginosa [TaxId:287] [109629] (1 PDB entry)
    Uniprot Q9HX49
  8. 2687785Domain d1tu9a1: 1tu9 A:2-130 [107320]
    Other proteins in same PDB: d1tu9a2
    complexed with edo, hem, ppi

Details for d1tu9a1

PDB Entry: 1tu9 (more details), 1.2 Å

PDB Description: Crystal Structure of a Protein PA3967, a Structurally Highly Homologous to a Human Hemoglobin, from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) hypothetical protein PA3967

SCOPe Domain Sequences for d1tu9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu9a1 a.1.1.2 (A:2-130) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}
naadrvmqsygrccastgffddfyrhflasspqirakfattdmtaqkhllragimnlvmy
argmsdsklralgashsraaldirpelydlwldallmavaehdrdcdaetrdawrdvmgr
giaviksyy

SCOPe Domain Coordinates for d1tu9a1:

Click to download the PDB-style file with coordinates for d1tu9a1.
(The format of our PDB-style files is described here.)

Timeline for d1tu9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tu9a2