Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hypothetical protein PA3967 [109628] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [109629] (1 PDB entry) Uniprot Q9HX49 |
Domain d1tu9a1: 1tu9 A:2-130 [107320] Other proteins in same PDB: d1tu9a2 complexed with edo, hem, ppi |
PDB Entry: 1tu9 (more details), 1.2 Å
SCOPe Domain Sequences for d1tu9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu9a1 a.1.1.2 (A:2-130) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]} naadrvmqsygrccastgffddfyrhflasspqirakfattdmtaqkhllragimnlvmy argmsdsklralgashsraaldirpelydlwldallmavaehdrdcdaetrdawrdvmgr giaviksyy
Timeline for d1tu9a1: