![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein (Pro)cathepsin K [54028] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54029] (31 PDB entries) Uniprot P43235 116-329 ! Uniprot P43235 115-329 |
![]() | Domain d1tu6b_: 1tu6 B: [107319] complexed with fsp, so4 |
PDB Entry: 1tu6 (more details), 1.75 Å
SCOPe Domain Sequences for d1tu6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu6b_ d.3.1.1 (B:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii knswgenwgnkgyilmarnknnacgianlasfpkm
Timeline for d1tu6b_: