SCOP 1.69: Domain d1tu6b_: 1tu6 B:

Lineage for d1tu6b_ (1tu6 B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (11 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (23 proteins)

6. Protein (Pro)cathepsin K [54028] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (17 PDB entries)

8. Domain d1tu6b_: 1tu6 B: [107319]

Details for d1tu6b_

PDB Entry: 1tu6, 1.75 Å

PDB Description: Cathepsin K complexed with a ketoamide inhibitor

SCOP Domain Sequences for d1tu6b_:

Sequence; same for both SEQRES and ATOM records:

>d1tu6b_ d.3.1.1 (B:) (Pro)cathepsin K {Human (Homo sapiens)}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1tu6b_:

• d1tu6b_ is new in SCOP 1.69
  
• d1tu6b_ appears in SCOP 1.71
  
• d1tu6b_ appears in the current release, SCOPe 2.08