SCOPe 2.07: Domain d1tu6a_: 1tu6 A:

Lineage for d1tu6a_ (1tu6 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin K [54028] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries)
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d1tu6a_: 1tu6 A: [107318]
   complexed with fsp, so4

Details for d1tu6a_

PDB Entry: 1tu6, 1.75 Å

PDB Description: Cathepsin K complexed with a ketoamide inhibitor

PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d1tu6a_:

Sequence; same for both SEQRES and ATOM records:

>d1tu6a_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1tu6a_:

• d1tu6a_ first appeared in SCOP 1.69
  
• d1tu6a_ appears in SCOPe 2.06
  
• d1tu6a_ appears in the current release, SCOPe 2.08