Lineage for d1tu1b1 (1tu1 B:1-142)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574956Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily)
    (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654
  4. 2574957Superfamily d.107.1: Mog1p/PsbP-like [55724] (5 families) (S)
  5. 2574977Family d.107.1.3: PA0094-like [111095] (1 protein)
    segment-swapped dimer; some sequence similarity to the PsbP-like family
    automatically mapped to Pfam PF08786
  6. 2574978Protein Hypothetical protein PA0094 [111096] (1 species)
  7. 2574979Species Pseudomonas aeruginosa [TaxId:287] [111097] (1 PDB entry)
    Uniprot Q9I738
  8. 2574981Domain d1tu1b1: 1tu1 B:1-142 [107317]
    Other proteins in same PDB: d1tu1a2, d1tu1b2
    Structural genomics target
    complexed with edo, peg, so4

Details for d1tu1b1

PDB Entry: 1tu1 (more details), 1.95 Å

PDB Description: crystal structure of protein of unknown function pa94 from pseudomonas aeruginosa, putative regulator
PDB Compounds: (B:) hypothetical protein PA0094

SCOPe Domain Sequences for d1tu1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu1b1 d.107.1.3 (B:1-142) Hypothetical protein PA0094 {Pseudomonas aeruginosa [TaxId: 287]}
mtlyrlheadleipdawqdqsinifklpasgpareasfvisrdasqgdapfadyvarqle
naekqlpgfklhkrwdinihghaavlldyqwqregrdlmlrqvfierrpavlittltttp
adlphhepawkqamqtlvprpt

SCOPe Domain Coordinates for d1tu1b1:

Click to download the PDB-style file with coordinates for d1tu1b1.
(The format of our PDB-style files is described here.)

Timeline for d1tu1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tu1b2