Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily) (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654 |
Superfamily d.107.1: Mog1p/PsbP-like [55724] (3 families) |
Family d.107.1.3: PA0094-like [111095] (1 protein) segment-swapped dimer; some sequence similarity to the PsbP-like family |
Protein Hypothetical protein PA0094 [111096] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [111097] (1 PDB entry) |
Domain d1tu1b_: 1tu1 B: [107317] Structural genomics target |
PDB Entry: 1tu1 (more details), 1.95 Å
SCOP Domain Sequences for d1tu1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu1b_ d.107.1.3 (B:) Hypothetical protein PA0094 {Pseudomonas aeruginosa} ghmtlyrlheadleipdawqdqsinifklpasgpareasfvisrdasqgdapfadyvarq lenaekqlpgfklhkrwdinihghaavlldyqwqregrdlmlrqvfierrpavlittltt tpadlphhepawkqamqtlvprpt
Timeline for d1tu1b_: