Lineage for d1tu1a_ (1tu1 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509325Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily)
    (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654
  4. 509326Superfamily d.107.1: Mog1p/PsbP-like [55724] (3 families) (S)
  5. 509337Family d.107.1.3: PA0094-like [111095] (1 protein)
    segment-swapped dimer; some sequence similarity to the PsbP-like family
  6. 509338Protein Hypothetical protein PA0094 [111096] (1 species)
  7. 509339Species Pseudomonas aeruginosa [TaxId:287] [111097] (1 PDB entry)
  8. 509340Domain d1tu1a_: 1tu1 A: [107316]

Details for d1tu1a_

PDB Entry: 1tu1 (more details), 1.95 Å

PDB Description: Crystal Structure of Protein of Unknown Function PA94 from Pseudomonas aeruginosa, Putative Regulator

SCOP Domain Sequences for d1tu1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu1a_ d.107.1.3 (A:) Hypothetical protein PA0094 {Pseudomonas aeruginosa}
ghmtlyrlheadleipdawqdqsinifklpasgpareasfvisrdasqgdapfadyvarq
lenaekqlpgfklhkrwdinihghaavlldyqwqregrdlmlrqvfierrpavlittltt
tpadlphhepawkqamqtlvprpt

SCOP Domain Coordinates for d1tu1a_:

Click to download the PDB-style file with coordinates for d1tu1a_.
(The format of our PDB-style files is described here.)

Timeline for d1tu1a_:

Domains from other chains:
(mouse over for more information)
d1tu1b_