Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily) (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654 |
Superfamily d.107.1: Mog1p/PsbP-like [55724] (5 families) |
Family d.107.1.3: PA0094-like [111095] (1 protein) segment-swapped dimer; some sequence similarity to the PsbP-like family automatically mapped to Pfam PF08786 |
Protein Hypothetical protein PA0094 [111096] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [111097] (1 PDB entry) Uniprot Q9I738 |
Domain d1tu1a1: 1tu1 A:1-142 [107316] Other proteins in same PDB: d1tu1a2, d1tu1b2 Structural genomics target complexed with edo, peg, so4 |
PDB Entry: 1tu1 (more details), 1.95 Å
SCOPe Domain Sequences for d1tu1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu1a1 d.107.1.3 (A:1-142) Hypothetical protein PA0094 {Pseudomonas aeruginosa [TaxId: 287]} mtlyrlheadleipdawqdqsinifklpasgpareasfvisrdasqgdapfadyvarqle naekqlpgfklhkrwdinihghaavlldyqwqregrdlmlrqvfierrpavlittltttp adlphhepawkqamqtlvprpt
Timeline for d1tu1a1: