![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) ![]() automatically mapped to Pfam PF02748 |
![]() | Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [57828] (63 PDB entries) Uniprot P00478 |
![]() | Domain d1tu0d2: 1tu0 D:101-153 [107315] Other proteins in same PDB: d1tu0a2, d1tu0a3, d1tu0b1, d1tu0c2, d1tu0c3, d1tu0d1 complexed with pct, zn; mutant |
PDB Entry: 1tu0 (more details), 2.55 Å
SCOPe Domain Sequences for d1tu0d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu0d2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]} eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan
Timeline for d1tu0d2: