![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) ![]() automatically mapped to Pfam PF01948 |
![]() | Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase [54895] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [54896] (63 PDB entries) Uniprot P00478 |
![]() | Domain d1tu0d1: 1tu0 D:1-100 [107314] Other proteins in same PDB: d1tu0a2, d1tu0a3, d1tu0b2, d1tu0c2, d1tu0c3, d1tu0d2 complexed with pct, zn; mutant |
PDB Entry: 1tu0 (more details), 2.55 Å
SCOPe Domain Sequences for d1tu0d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu0d1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik ientflsedqvdqlalyapqatvnridnyevvgksrpslp
Timeline for d1tu0d1: