Lineage for d1tu0d1 (1tu0 D:1-100)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
    Uniprot P00478
  8. Domain d1tu0d1: 1tu0 D:1-100 [107314]
    Other proteins in same PDB: d1tu0a2, d1tu0a3, d1tu0b2, d1tu0c2, d1tu0c3, d1tu0d2
    complexed with pct, zn; mutant

Details for d1tu0d1

PDB Entry: 1tu0 (more details), 2.55 Å

PDB Description: Aspartate Transcarbamoylase Catalytic Chain Mutant E50A Complex with Phosphonoacetamide
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1tu0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu0d1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d1tu0d1 are not available.

Timeline for d1tu0d1:

Domains from same chain:
(mouse over for more information)
d1tu0d2
Domains from other chains:
(mouse over for more information)
d1tu0a2, d1tu0a3, d1tu0b1, d1tu0b2, d1tu0c2, d1tu0c3