Lineage for d1ttza_ (1ttz A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 698984Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 699021Protein Hypothetical protein XCC2852 [110606] (1 species)
  7. 699022Species Xanthomonas campestris [TaxId:339] [110607] (2 PDB entries)
  8. 699023Domain d1ttza_: 1ttz A: [107309]

Details for d1ttza_

PDB Entry: 1ttz (more details), 2.11 Å

PDB Description: x-ray structure of northeast structural genomics target protein xcr50 from x. campestris
PDB Compounds: (A:) conserved hypothetical protein

SCOP Domain Sequences for d1ttza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]}
altlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreldw
pfdaprlrawldaap

SCOP Domain Coordinates for d1ttza_:

Click to download the PDB-style file with coordinates for d1ttza_.
(The format of our PDB-style files is described here.)

Timeline for d1ttza_: