SCOPe 2.08: Domain d1ttza1: 1ttz A:6-76

Lineage for d1ttza1 (1ttz A:6-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Hypothetical protein XCC2852 [110606] (1 species)

7. Species Xanthomonas campestris [TaxId:339] [110607] (2 PDB entries)
   Uniprot Q8P6W3

8. Domain d1ttza1: 1ttz A:6-76 [107309]
   Other proteins in same PDB: d1ttza2

Details for d1ttza1

PDB Entry: 1ttz, 2.11 Å

PDB Description: x-ray structure of northeast structural genomics target protein xcr50 from x. campestris

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1ttza1:

Sequence; same for both SEQRES and ATOM records:

>d1ttza1 c.47.1.1 (A:6-76) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]}
yqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreldwpfda
prlrawldaap

Timeline for d1ttza1:

• d1ttza1 first appeared in SCOP 1.69, called d1ttza_
  
• d1ttza1 appears in SCOPe 2.07