Lineage for d1ttwa_ (1ttw A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515686Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 515687Superfamily d.198.1: Type III secretory system chaperone [69635] (1 family) (S)
  5. 515688Family d.198.1.1: Type III secretory system chaperone [69636] (7 proteins)
    the family sequences are very divergent
  6. 515695Protein Putative YopH chaperone SycH [110790] (1 species)
  7. 515696Species Yersinia pestis [TaxId:632] [110791] (1 PDB entry)
  8. 515697Domain d1ttwa_: 1ttw A: [107308]
    complexed with YscM2 peptide (SQ O54481 37-56), chain B

Details for d1ttwa_

PDB Entry: 1ttw (more details), 2.38 Å

PDB Description: crystal structure of the yersinia pestis type iii secretion chaperone sych in complex with a stable fragment of yscm2

SCOP Domain Sequences for d1ttwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttwa_ d.198.1.1 (A:) Putative YopH chaperone SycH {Yersinia pestis}
tysslleefatelgleeietnelghgavtidkiwvvhlapinekelvafmragiltgqsq
lydilrknlfsplsgvircaldkddhwllwsqlnindtsgtqlasvltslvdkavtls

SCOP Domain Coordinates for d1ttwa_:

Click to download the PDB-style file with coordinates for d1ttwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ttwa_: