![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) ![]() |
![]() | Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins) the family sequences are very divergent |
![]() | Protein Putative YopH chaperone SycH [110790] (1 species) |
![]() | Species Yersinia pestis [TaxId:632] [110791] (1 PDB entry) Uniprot Q7ARG9 |
![]() | Domain d1ttwa_: 1ttw A: [107308] complexed with YscM2 peptide (Uniprot O54481 37-56), chain B |
PDB Entry: 1ttw (more details), 2.38 Å
SCOPe Domain Sequences for d1ttwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ttwa_ d.198.1.1 (A:) Putative YopH chaperone SycH {Yersinia pestis [TaxId: 632]} tysslleefatelgleeietnelghgavtidkiwvvhlapinekelvafmragiltgqsq lydilrknlfsplsgvircaldkddhwllwsqlnindtsgtqlasvltslvdkavtls
Timeline for d1ttwa_: